Lineage for d3puwf1 (3puw F:10-260)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3020733Fold e.70: MalF N-terminal region-like [160963] (1 superfamily)
    consists of 3 N-terminal transmembrane helices, an alpha+beta linker domain and a beta-barrel (n=7; S=8) with one overside loop
  4. 3020734Superfamily e.70.1: MalF N-terminal region-like [160964] (1 family) (S)
  5. 3020735Family e.70.1.1: MalF N-terminal region-like [160965] (1 protein)
    PfamB PB001917
  6. 3020736Protein Maltose transport system permease protein MalF [160966] (1 species)
  7. 3020737Species Escherichia coli [TaxId:562] [160967] (10 PDB entries)
    Uniprot P02916 13-260
  8. 3020739Domain d3puwf1: 3puw F:10-260 [200241]
    Other proteins in same PDB: d3puwa1, d3puwa2, d3puwa3, d3puwb1, d3puwb2, d3puwe1, d3puwe2, d3puwf2, d3puwg_
    automated match to d2r6gf1
    complexed with adp, alf, mg, pgv, umq

Details for d3puwf1

PDB Entry: 3puw (more details), 2.3 Å

PDB Description: crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-alf4
PDB Compounds: (F:) Maltose transport system permease protein malF

SCOPe Domain Sequences for d3puwf1:

Sequence, based on SEQRES records: (download)

>d3puwf1 e.70.1.1 (F:10-260) Maltose transport system permease protein MalF {Escherichia coli [TaxId: 562]}
wqsdalkwsvlgllgllvgylvvlmyaqgeylfaittlilssaglyifanrkayawryvy
pgmagmglfvlfplvctiaiaftnysstnqltferaqevlldrswqagktynfglypagd
ewqlalsdgetgknylsdafkfggeqklqlkettaqpegeranlrvitqnrqalsditai
lpdgnkvmmsslrqfsgtqplytldgdgtltnnqsgvkyrpnnqigfyqsitadgnwgde
klspgytvttg

Sequence, based on observed residues (ATOM records): (download)

>d3puwf1 e.70.1.1 (F:10-260) Maltose transport system permease protein MalF {Escherichia coli [TaxId: 562]}
wqsdalkwsvlgllgllvgylvvlmyaqgeylfaittlilssaglyifanrkayawryvy
pgmagmglfvlfplvctiaiaftnysstnqltferaqevlldrswqagktynfglypagd
ewqlalsdgetgknylsdafkfggeqklqlkettaqpegeranlrvitqnrqalsditai
lpdgnkvmmsslrqfsgtqplytldgdgtltnnqsgvkyrpnnqigfyqsinwgdeklsp
gytvttg

SCOPe Domain Coordinates for d3puwf1:

Click to download the PDB-style file with coordinates for d3puwf1.
(The format of our PDB-style files is described here.)

Timeline for d3puwf1: