Lineage for d3puwa1 (3puw A:2-235)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1845072Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1845073Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1848535Family c.37.1.12: ABC transporter ATPase domain-like [52686] (24 proteins)
    there are two additional subdomains inserted into the central core that has a RecA-like topology
  6. 1848652Protein Maltose transport protein MalK, N-terminal domain [52689] (2 species)
  7. 1848653Species Escherichia coli [TaxId:562] [102380] (15 PDB entries)
  8. 1848656Domain d3puwa1: 3puw A:2-235 [200236]
    Other proteins in same PDB: d3puwa2, d3puwb2, d3puwe_, d3puwf1, d3puwf2, d3puwg_
    automated match to d1q12a2
    complexed with adp, alf, mal, mg, pgv, umq

Details for d3puwa1

PDB Entry: 3puw (more details), 2.3 Å

PDB Description: crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-alf4
PDB Compounds: (A:) Maltose/maltodextrin import ATP-binding protein malK

SCOPe Domain Sequences for d3puwa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3puwa1 c.37.1.12 (A:2-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]}
asvqlqnvtkawgevvvskdinldihegefvvfvgpsgcgkstllrmiagletitsgdlf
igekrmndtppaergvgmvfqsyalyphlsvaenmsfglklagakkevinqrvnqvaevl
qlahlldrkpkalsggqrqrvaigrtlvaepsvflldeplsnldaalrvqmrieisrlhk
rlgrtmiyvthdqveamtladkivvldagrvaqvgkplelyhypadrfvagfig

SCOPe Domain Coordinates for d3puwa1:

Click to download the PDB-style file with coordinates for d3puwa1.
(The format of our PDB-style files is described here.)

Timeline for d3puwa1: