SCOPe 2.05: Domain d3puvf2: 3puv F:261-503

Lineage for d3puvf2 (3puv F:261-503)

1. Root: SCOPe 2.05

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.58: MetI-like [161097] (1 superfamily)
   core: 5 transmembrane helices; flattened bundle

4. Superfamily f.58.1: MetI-like [161098] (1 family)

5. Family f.58.1.1: MetI-like [161099] (6 proteins)
   Pfam PF00528; Binding-protein-dependent transport system inner membrane component

6. Protein Maltose transport system permease protein MalF [161106] (1 species)

7. Species Escherichia coli [TaxId:562] [161107] (10 PDB entries)
   Uniprot P02916 261-504

8. Domain d3puvf2: 3puv F:261-503 [200235]
   Other proteins in same PDB: d3puva1, d3puva2, d3puvb1, d3puvb2, d3puve_, d3puvf1, d3puvg_
   automated match to d2r6gf2
   complexed with adp, mal, mg, pgv, umq, vo4

Details for d3puvf2

PDB Entry: 3puv, 2.4 Å

PDB Description: crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-vo4

PDB Compounds: (F:) Maltose transport system permease protein malF

SCOPe Domain Sequences for d3puvf2:

Sequence; same for both SEQRES and ATOM records:

>d3puvf2 f.58.1.1 (F:261-503) Maltose transport system permease protein MalF {Escherichia coli [TaxId: 562]}
wknftrvftdegiqkpflaifvwtvvfslitvfltvavgmvlaclvqwealrgkavyrvl
lilpyavpsfisilifkglfnqsfgeinmmlsalfgvkpawfsdpttartmliivntwlg
ypymmilcmgllkaipddlyeasamdgagpfqnffkitlpllikpltplmiasfafnfnn
fvliqlltnggpdrlgtttpagytdllvnytyriafeggggqdfglaaaiatlifllvga
lai

Timeline for d3puvf2:

• d3puvf2 first appeared in SCOPe 2.03
  
• d3puvf2 appears in SCOPe 2.04
  
• d3puvf2 appears in SCOPe 2.06
  
• d3puvf2 appears in the current release, SCOPe 2.08