SCOPe 2.06: Domain d3poxf_: 3pox F:

Lineage for d3poxf_ (3pox F:)

1. Root: SCOPe 2.06

2. Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)

3. Fold f.4: Transmembrane beta-barrels [56924] (7 superfamilies)
   not a true fold, gathers together transmembrane barrels of different (n,S)

4. Superfamily f.4.3: Porins [56935] (5 families)

5. Family f.4.3.1: Porin [56936] (2 proteins)
   trimer, one subunit folds into (16,20) barrel

6. Protein Porin [56937] (5 species)

7. Species Escherichia coli, different sequences [TaxId:562] [56938] (27 PDB entries)

8. Domain d3poxf_: 3pox F: [200228]
   automated match to d2omfa_
   complexed with k, olc, scn

Details for d3poxf_

PDB Entry: 3pox, 2 Å

PDB Description: Crystal Structure of E.coli OmpF porin in lipidic cubic phase: space group P1

PDB Compounds: (F:) OmpF protein

SCOPe Domain Sequences for d3poxf_:

Sequence; same for both SEQRES and ATOM records:

>d3poxf_ f.4.3.1 (F:) Porin {Escherichia coli, different sequences [TaxId: 562]}
aeiynkdgnkvdlygkavglhyfskgngensyggngdmtyarlgfkgetqinsdltgygq
weynfqgnnsegadaqtgnktrlafaglkyadvgsfdygrnygvvydalgytdmlpefgg
dtaysddffvgrvggvatyrnsnffglvdglnfavqylgknerdtarrsngdgvggsisy
eyegfgivgaygaadrtnlqeaqplgngkkaeqwatglkydanniylaanygetrnatpi
tnkftntsgfanktqdvllvaqyqfdfglrpsiaytkskakdvegigdvdlvnyfevgat
yyfnknmstyvdyiinqidsdnklgvgsddtvavgivyqf

Timeline for d3poxf_:

• d3poxf_ first appeared in SCOPe 2.03
  
• d3poxf_ appears in SCOPe 2.05
  
• d3poxf_ appears in SCOPe 2.07
  
• d3poxf_ appears in the current release, SCOPe 2.08