SCOPe 2.08: Domain d3peac1: 3pea C:1-257

Lineage for d3peac1 (3pea C:1-257)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.14: ClpP/crotonase [52095] (1 superfamily)
   core: 4 turns of (beta-beta-alpha)n superhelix

4. Superfamily c.14.1: ClpP/crotonase [52096] (5 families)

5. Family c.14.1.0: automated matches [191346] (1 protein)
   not a true family

6. Protein automated matches [190246] (71 species)
   not a true protein

7. Species Bacillus anthracis [TaxId:261594] [196404] (1 PDB entry)

8. Domain d3peac1: 3pea C:1-257 [200212]
   Other proteins in same PDB: d3peac2
   automated match to d3peaf_
   complexed with act, flc, pg4

Details for d3peac1

PDB Entry: 3pea, 1.82 Å

PDB Description: crystal structure of enoyl-coa hydratase from bacillus anthracis str. 'ames ancestor'

PDB Compounds: (C:) Enoyl-CoA hydratase/isomerase family protein

SCOPe Domain Sequences for d3peac1:

Sequence; same for both SEQRES and ATOM records:

>d3peac1 c.14.1.0 (C:1-257) automated matches {Bacillus anthracis [TaxId: 261594]}
mlkflsvrvedhiavatlnhapanamssqvmhdvtelidqvekddnirvvvihgegrffs
agadikeftsvteakqatelaqlgqvtfervekcskpviaaihgaalggglefamschmr
fatesaklglpeltlglipgfagtqrlpryvgkakacemmltstpitgaealkwglvngv
faeetflddtlkvakqiagkspataravlellqttksshyyegvqreaqifgevftsedg
regvaaflekrkpsfsg

Timeline for d3peac1:

• d3peac1 first appeared in SCOPe 2.03, called d3peac_
  
• d3peac1 appears in SCOPe 2.07