Lineage for d3p9we_ (3p9w E:)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2260390Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. 2260391Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) (S)
  5. 2260392Family g.17.1.1: Platelet-derived growth factor-like [57502] (4 proteins)
  6. 2260465Protein automated matches [190290] (1 species)
    not a true protein
  7. 2260466Species Human (Homo sapiens) [TaxId:9606] [187095] (7 PDB entries)
  8. 2260469Domain d3p9we_: 3p9w E: [200207]
    Other proteins in same PDB: d3p9wb_, d3p9wd_, d3p9wf_, d3p9wh_
    automated match to d3p9wc_

Details for d3p9we_

PDB Entry: 3p9w (more details), 2.41 Å

PDB Description: Crystal structure of an engineered human autonomous VH Domain in complex with VEGF
PDB Compounds: (E:) Vascular Endothelial Growth Factor A

SCOPe Domain Sequences for d3p9we_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3p9we_ g.17.1.1 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hevvkfmdvyqrsychpietlvdifqeypdeieyifkpscvplmrcggccndeglecvpt
eesnitmqimrikphqgqhigemsflqhnkcecrpkk

SCOPe Domain Coordinates for d3p9we_:

Click to download the PDB-style file with coordinates for d3p9we_.
(The format of our PDB-style files is described here.)

Timeline for d3p9we_: