Lineage for d3p8ma_ (3p8m A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2188797Fold d.39: DLC [54647] (1 superfamily)
    core: beta-alpha(2)-beta-X-beta(2); 2 layers: alpha/beta; antiparallel beta-sheet: order 1342
  4. 2188798Superfamily d.39.1: DLC [54648] (1 family) (S)
    automatically mapped to Pfam PF01221
  5. 2188799Family d.39.1.1: DLC [54649] (3 proteins)
    8 kDa dynein light chain, DLC8
  6. 2188840Protein automated matches [190350] (4 species)
    not a true protein
  7. 2188843Species Human (Homo sapiens) [TaxId:9606] [196192] (1 PDB entry)
  8. 2188844Domain d3p8ma_: 3p8m A: [200205]
    automated match to d3p8mb_

Details for d3p8ma_

PDB Entry: 3p8m (more details), 2.9 Å

PDB Description: Human dynein light chain (DYNLL2) in complex with an in vitro evolved peptide dimerized by leucine zipper
PDB Compounds: (A:) dynein light chain 2

SCOPe Domain Sequences for d3p8ma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3p8ma_ d.39.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
drkaviknadmsedmqqdavdcatqamekyniekdiaayikkefdkkynptwhcivgrnf
gsyvthetkhfiyfylgqvaillfksg

SCOPe Domain Coordinates for d3p8ma_:

Click to download the PDB-style file with coordinates for d3p8ma_.
(The format of our PDB-style files is described here.)

Timeline for d3p8ma_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3p8mb_