Lineage for d3p77a1 (3p77 A:0-177)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2163004Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2163005Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2163984Family d.19.1.0: automated matches [227140] (1 protein)
    not a true family
  6. 2163985Protein automated matches [226842] (4 species)
    not a true protein
  7. 2163986Species Chicken (Gallus gallus) [TaxId:9031] [225828] (8 PDB entries)
  8. 2163988Domain d3p77a1: 3p77 A:0-177 [200203]
    Other proteins in same PDB: d3p77a2, d3p77b_
    automated match to d1de4a2
    complexed with 2pe, act, pge

Details for d3p77a1

PDB Entry: 3p77 (more details), 1.6 Å

PDB Description: Crystal Structures of the Chicken YF1*7.1 molecule
PDB Compounds: (A:) MHC Rfp-Y class I alpha chain

SCOPe Domain Sequences for d3p77a1:

Sequence, based on SEQRES records: (download)

>d3p77a1 d.19.1.0 (A:0-177) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
fgshslryfltgmtdpgpgmprfvivgyvddkifgtynsksrtaqpivemlpqedqehwd
tqtqkaqggerdfdwnlnrlperynkskgshtmqmmfgcdiledgsirgydqyafdgrdf
lafdmdtmtftaadpvaeitkrrwetegtyaerwkhelgtvcvqnlrrylehgkaalk

Sequence, based on observed residues (ATOM records): (download)

>d3p77a1 d.19.1.0 (A:0-177) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
fgshslryfltgmtdpgpgmprfvivgyvddkifgtynsksrtaqpivemlpqedqehwd
tqtqkaqggerdfdwnlnrlperynkgshtmqmmfgcdiledgsirgydqyafdgrdfla
fdmdtmtftaadpvaeitkrrwetegtyaerwkhelgtvcvqnlrrylehgkaalk

SCOPe Domain Coordinates for d3p77a1:

Click to download the PDB-style file with coordinates for d3p77a1.
(The format of our PDB-style files is described here.)

Timeline for d3p77a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3p77a2
View in 3D
Domains from other chains:
(mouse over for more information)
d3p77b_