SCOPe 2.08: Domain d3p73a2: 3p73 A:178-273

Lineage for d3p73a2 (3p73 A:178-273)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Chicken (Gallus gallus) [TaxId:9031] [188287] (28 PDB entries)

8. Domain d3p73a2: 3p73 A:178-273 [200202]
   Other proteins in same PDB: d3p73a1
   automated match to d1de4a1
   complexed with 16a, act

Details for d3p73a2

PDB Entry: 3p73, 1.32 Å

PDB Description: Crystal Structures of the Chicken YF1*7.1 molecule

PDB Compounds: (A:) MHC Rfp-Y class I alpha chain

SCOPe Domain Sequences for d3p73a2:

Sequence; same for both SEQRES and ATOM records:

>d3p73a2 b.1.1.0 (A:178-273) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
rrvqpevrvwgkeadgiltlschahgfyprpitiswmkdgmvrdqetrwggivpnsdgty
hasaaidvlpedgdkywcrvehaslpqpglfswepq

Timeline for d3p73a2:

• d3p73a2 first appeared in SCOPe 2.03
  
• d3p73a2 appears in SCOPe 2.07