Lineage for d3p71t_ (3p71 T:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2500487Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2500488Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2502162Family c.66.1.0: automated matches [191451] (1 protein)
    not a true family
  6. 2502163Protein automated matches [190689] (81 species)
    not a true protein
  7. 2502371Species Human (Homo sapiens) [TaxId:9606] [187871] (32 PDB entries)
  8. 2502444Domain d3p71t_: 3p71 T: [200200]
    Other proteins in same PDB: d3p71c_
    automated match to d1rjdb_
    complexed with an6, mn, peg

Details for d3p71t_

PDB Entry: 3p71 (more details), 2.7 Å

PDB Description: Crystal structure of the complex of LCMT-1 and PP2A
PDB Compounds: (T:) Leucine carboxyl methyltransferase 1

SCOPe Domain Sequences for d3p71t_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3p71t_ c.66.1.0 (T:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dendegvrgtcedaslckrfavsigywhdpyiqhfvrlskerkapeinrgyfarvhgvsq
likaflrktechcqivnlgagmdttfwrlkdedllsskyfevdfpmivtrklhsikckpp
lsspilelhsedtlqmdghildskryavigadlrdlseleeklkkcnmntqlptlliaec
vlvymtpeqsanllkwaansferamfinyeqvnmgdrfgqimienlrrrqcdlagvetck
slesqkerllsngwetasavdmmelynrlpraevsrieslefldemelleqlmrhyclcw
atkggnelglkeity

SCOPe Domain Coordinates for d3p71t_:

Click to download the PDB-style file with coordinates for d3p71t_.
(The format of our PDB-style files is described here.)

Timeline for d3p71t_: