Lineage for d3p5me_ (3p5m E:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2099098Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2099099Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2100042Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. 2100043Protein automated matches [190246] (54 species)
    not a true protein
  7. 2100325Species Mycobacterium avium [TaxId:243243] [189433] (5 PDB entries)
  8. 2100331Domain d3p5me_: 3p5m E: [200199]
    Other proteins in same PDB: d3p5ma2, d3p5mb2, d3p5mc2, d3p5md2, d3p5mf2
    automated match to d3p5mf_
    complexed with edo

Details for d3p5me_

PDB Entry: 3p5m (more details), 2.05 Å

PDB Description: crystal structure of an enoyl-coa hydratase/isomerase from mycobacterium avium
PDB Compounds: (E:) enoyl-CoA hydratase/isomerase

SCOPe Domain Sequences for d3p5me_:

Sequence, based on SEQRES records: (download)

>d3p5me_ c.14.1.0 (E:) automated matches {Mycobacterium avium [TaxId: 243243]}
mngisvehdgavlrirldrpeklnavdtpmleelsvhirdaeadesvravlltgagrafc
sggdltggdtagaadaanrvvraitslpkpviagvhgaavgfgcslalacdlvvaapasy
fqlaftrvglmpdggasallplligrartsrmamtaekisaatafewgmishitsadeye
svltdvlrsvsggptlafgwtkralaaatlaelepvqaieaegqlalvetadfregaraf
rerrtpnfrgh

Sequence, based on observed residues (ATOM records): (download)

>d3p5me_ c.14.1.0 (E:) automated matches {Mycobacterium avium [TaxId: 243243]}
mngisvehdgavlrirldrpeklnavdtpmleelsvhirdaeadesvravlltgagrafc
sggggdtagaadaanrvvraitslpkpviagvhgaavgfgcslalacdlvvaapasyfql
aftrvglmpdggasallplligrartsrmamtaekisaatafewgmishitsadeyesvl
tdvlrsvsggptlafgwtkralaaatlaelepvqaieaegqlalvetadfregarafrer
rtpnfrgh

SCOPe Domain Coordinates for d3p5me_:

Click to download the PDB-style file with coordinates for d3p5me_.
(The format of our PDB-style files is described here.)

Timeline for d3p5me_: