Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
Superfamily c.14.1: ClpP/crotonase [52096] (5 families) |
Family c.14.1.0: automated matches [191346] (1 protein) not a true family |
Protein automated matches [190246] (46 species) not a true protein |
Species Mycobacterium avium [TaxId:243243] [189433] (5 PDB entries) |
Domain d3p5md_: 3p5m D: [200198] automated match to d3p5mf_ complexed with edo |
PDB Entry: 3p5m (more details), 2.05 Å
SCOPe Domain Sequences for d3p5md_:
Sequence, based on SEQRES records: (download)
>d3p5md_ c.14.1.0 (D:) automated matches {Mycobacterium avium [TaxId: 243243]} smngisvehdgavlrirldrpeklnavdtpmleelsvhirdaeadesvravlltgagraf csggdltggdtagaadaanrvvraitslpkpviagvhgaavgfgcslalacdlvvaapas yfqlaftrvglmpdggasallplligrartsrmamtaekisaatafewgmishitsadey esvltdvlrsvsggptlafgwtkralaaatlaelepvqaieaegqlalvetadfregara frerrtpnfrgh
>d3p5md_ c.14.1.0 (D:) automated matches {Mycobacterium avium [TaxId: 243243]} smngisvehdgavlrirldrpeklnavdtpmleelsvhirdaeadesvravlltgagraf csggddtagaadaanrvvraitslpkpviagvhgaavgfgcslalacdlvvaapasyfql aftrvglmpdggasallplligrartsrmamtaekisaatafewgmishitsadeyesvl tdvlrsvsggptlafgwtkralaaatlaelepvqaieaegqlalvetadfregarafrer rtpnfrgh
Timeline for d3p5md_: