![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
![]() | Superfamily c.14.1: ClpP/crotonase [52096] (5 families) ![]() |
![]() | Family c.14.1.0: automated matches [191346] (1 protein) not a true family |
![]() | Protein automated matches [190246] (71 species) not a true protein |
![]() | Species Mycobacterium avium [TaxId:243243] [189433] (5 PDB entries) |
![]() | Domain d3p5md1: 3p5m D:1-251 [200198] Other proteins in same PDB: d3p5ma2, d3p5mb2, d3p5mc2, d3p5md2, d3p5mf2 automated match to d3p5mf_ complexed with edo |
PDB Entry: 3p5m (more details), 2.05 Å
SCOPe Domain Sequences for d3p5md1:
Sequence, based on SEQRES records: (download)
>d3p5md1 c.14.1.0 (D:1-251) automated matches {Mycobacterium avium [TaxId: 243243]} mngisvehdgavlrirldrpeklnavdtpmleelsvhirdaeadesvravlltgagrafc sggdltggdtagaadaanrvvraitslpkpviagvhgaavgfgcslalacdlvvaapasy fqlaftrvglmpdggasallplligrartsrmamtaekisaatafewgmishitsadeye svltdvlrsvsggptlafgwtkralaaatlaelepvqaieaegqlalvetadfregaraf rerrtpnfrgh
>d3p5md1 c.14.1.0 (D:1-251) automated matches {Mycobacterium avium [TaxId: 243243]} mngisvehdgavlrirldrpeklnavdtpmleelsvhirdaeadesvravlltgagrafc sggddtagaadaanrvvraitslpkpviagvhgaavgfgcslalacdlvvaapasyfqla ftrvglmpdggasallplligrartsrmamtaekisaatafewgmishitsadeyesvlt dvlrsvsggptlafgwtkralaaatlaelepvqaieaegqlalvetadfregarafrerr tpnfrgh
Timeline for d3p5md1: