Lineage for d3p5mc_ (3p5m C:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1353895Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 1353896Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 1354733Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. 1354734Protein automated matches [190246] (42 species)
    not a true protein
  7. 1354963Species Mycobacterium avium [TaxId:243243] [189433] (5 PDB entries)
  8. 1354970Domain d3p5mc_: 3p5m C: [200197]
    automated match to d3p5mf_
    complexed with edo

Details for d3p5mc_

PDB Entry: 3p5m (more details), 2.05 Å

PDB Description: crystal structure of an enoyl-coa hydratase/isomerase from mycobacterium avium
PDB Compounds: (C:) enoyl-CoA hydratase/isomerase

SCOPe Domain Sequences for d3p5mc_:

Sequence, based on SEQRES records: (download)

>d3p5mc_ c.14.1.0 (C:) automated matches {Mycobacterium avium [TaxId: 243243]}
gpgsmngisvehdgavlrirldrpeklnavdtpmleelsvhirdaeadesvravlltgag
rafcsggdltggdtagaadaanrvvraitslpkpviagvhgaavgfgcslalacdlvvaa
pasyfqlaftrvglmpdggasallplligrartsrmamtaekisaatafewgmishitsa
deyesvltdvlrsvsggptlafgwtkralaaatlaelepvqaieaegqlalvetadfreg
arafrerrtpnfrgh

Sequence, based on observed residues (ATOM records): (download)

>d3p5mc_ c.14.1.0 (C:) automated matches {Mycobacterium avium [TaxId: 243243]}
gpgsmngisvehdgavlrirldrpeklnavdtpmleelsvhirdaeadesvravlltgag
rafcsggddtagaadaanrvvraitslpkpviagvhgaavgfgcslalacdlvvaapasy
fqlaftrvglmpdggasallplligrartsrmamtaekisaatafewgmishitsadeye
svltdvlrsvsggptlafgwtkralaaatlaelepvqaieaegqlalvetadfregaraf
rerrtpnfrgh

SCOPe Domain Coordinates for d3p5mc_:

Click to download the PDB-style file with coordinates for d3p5mc_.
(The format of our PDB-style files is described here.)

Timeline for d3p5mc_: