Lineage for d3p4pn2 (3p4p N:106-243)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2689591Superfamily a.1.2: alpha-helical ferredoxin [46548] (3 families) (S)
    contains two Fe4-S4 clusters
  5. 2689592Family a.1.2.1: Fumarate reductase/Succinate dehydogenase iron-sulfur protein, C-terminal domain [46549] (3 proteins)
  6. 2689593Protein Fumarate reductase [46550] (3 species)
  7. 2689594Species Escherichia coli [TaxId:362663] [224841] (1 PDB entry)
  8. 2689596Domain d3p4pn2: 3p4p N:106-243 [200194]
    Other proteins in same PDB: d3p4pb1, d3p4pc_, d3p4pd_, d3p4pn1, d3p4po_, d3p4pp_
    automated match to d1kf6b1
    complexed with f3s, fad, fes, fum, sf4

Details for d3p4pn2

PDB Entry: 3p4p (more details), 2.8 Å

PDB Description: crystal structure of menaquinol:fumarate oxidoreductase in complex with fumarate
PDB Compounds: (N:) fumarate reductase iron-sulfur protein

SCOPe Domain Sequences for d3p4pn2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3p4pn2 a.1.2.1 (N:106-243) Fumarate reductase {Escherichia coli [TaxId: 362663]}
mthfiesleaikpyiignsrtadqgtniqtpaqmakyhqfsgcincglcyaacpqfglnp
efigpaaitlahrynedsrdhgkkermaqlnsqngvwsctfvgycsevcpkhvdpaaaiq
qgkvesskdfliatlkpr

SCOPe Domain Coordinates for d3p4pn2:

Click to download the PDB-style file with coordinates for d3p4pn2.
(The format of our PDB-style files is described here.)

Timeline for d3p4pn2: