![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) ![]() |
![]() | Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (14 proteins) |
![]() | Protein Fumarate reductase iron-sulfur protein, N-terminal domain [54325] (3 species) |
![]() | Species Escherichia coli [TaxId:362663] [224921] (1 PDB entry) |
![]() | Domain d3p4pn1: 3p4p N:1-105 [200193] Other proteins in same PDB: d3p4pb2, d3p4pc_, d3p4pd_, d3p4pn2, d3p4po_, d3p4pp_ automated match to d1kf6b2 complexed with f3s, fad, fes, fum, sf4 |
PDB Entry: 3p4p (more details), 2.8 Å
SCOPe Domain Sequences for d3p4pn1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3p4pn1 d.15.4.2 (N:1-105) Fumarate reductase iron-sulfur protein, N-terminal domain {Escherichia coli [TaxId: 362663]} aemknlkievvrynpevdtaphsafyevpydattslldalgyikdnlapdlsyrwscrma icgscgmmvnnvpklacktflrdytdgmkvealanfpierdlvvd
Timeline for d3p4pn1: