SCOP 1.69: Domain d1mreh1: 1mre H:1-115

Lineage for d1mreh1 (1mre H:1-115)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (27 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (143 PDB entries)

8. Domain d1mreh1: 1mre H:1-115 [20019]
   Other proteins in same PDB: d1mreh2, d1mrel1, d1mrel2
   part of Fab Jel 103

Details for d1mreh1

PDB Entry: 1mre, 2.3 Å

PDB Description: preparation, characterization and crystallization of an antibody fab fragment that recognizes rna. crystal structures of native fab and three fab-mononucleotide complexes

SCOP Domain Sequences for d1mreh1:

Sequence, based on SEQRES records:

>d1mreh1 b.1.1.1 (H:1-115) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2}
qvqlqqsgaelvkpgasvklsckasgytftsywmqwvkqrpgqglewigeidpsdsytny
nqkfkgkatltvdtssstaymqlssltsedsavyycanlrgyfdywgqgttltvssak

Sequence, based on observed residues (ATOM records):

>d1mreh1 b.1.1.1 (H:1-115) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2}
qvqlqqsgaelvkpgasvklsckasgytftsywmqwvkqrpgqglewigeidpsdsytny
nqkfkgkatltvdstaymqlssltsedsavyycanlrgyfdywgqgttltvssak

Timeline for d1mreh1:

• d1mreh1 first appeared (with stable ids) in SCOP 1.55
  
• d1mreh1 appears in SCOP 1.67
  
• d1mreh1 appears in SCOP 1.71
  
• d1mreh1 appears in the current release, SCOPe 2.08