Lineage for d1mreh1 (1mre H:1-115)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 287097Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (21 proteins)
  6. 287195Protein Immunoglobulin heavy chain variable domain, VH [88543] (19 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogeneous CDRs are listed as engineered species
  7. 287419Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (118 PDB entries)
  8. 287464Domain d1mreh1: 1mre H:1-115 [20019]
    Other proteins in same PDB: d1mreh2, d1mrel1, d1mrel2
    part of Fab Jel 103
    complexed with gdp, imd, zn

Details for d1mreh1

PDB Entry: 1mre (more details), 2.3 Å

PDB Description: preparation, characterization and crystallization of an antibody fab fragment that recognizes rna. crystal structures of native fab and three fab-mononucleotide complexes

SCOP Domain Sequences for d1mreh1:

Sequence, based on SEQRES records: (download)

>d1mreh1 b.1.1.1 (H:1-115) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2}
qvqlqqsgaelvkpgasvklsckasgytftsywmqwvkqrpgqglewigeidpsdsytny
nqkfkgkatltvdtssstaymqlssltsedsavyycanlrgyfdywgqgttltvssak

Sequence, based on observed residues (ATOM records): (download)

>d1mreh1 b.1.1.1 (H:1-115) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2}
qvqlqqsgaelvkpgasvklsckasgytftsywmqwvkqrpgqglewigeidpsdsytny
nqkfkgkatltvdstaymqlssltsedsavyycanlrgyfdywgqgttltvssak

SCOP Domain Coordinates for d1mreh1:

Click to download the PDB-style file with coordinates for d1mreh1.
(The format of our PDB-style files is described here.)

Timeline for d1mreh1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mreh2