Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
Fold e.22: Dehydroquinate synthase-like [56795] (1 superfamily) 2 domains: (1) alpha/beta of a Rossmann-fold topology, binds NAD (2) multihelical array |
Superfamily e.22.1: Dehydroquinate synthase-like [56796] (3 families) |
Family e.22.1.0: automated matches [191565] (1 protein) not a true family |
Protein automated matches [190982] (12 species) not a true protein |
Species Zymomonas mobilis [TaxId:542] [196376] (2 PDB entries) |
Domain d3ox4b_: 3ox4 B: [200183] automated match to d3ox4d_ complexed with fe2, nad |
PDB Entry: 3ox4 (more details), 2 Å
SCOPe Domain Sequences for d3ox4b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ox4b_ e.22.1.0 (B:) automated matches {Zymomonas mobilis [TaxId: 542]} asstfyipfvnemgegslekaikdlngsgfknalivsdafmnksgvvkqvadllkaqgin savydgvmpnptvtavleglkilkdnnsdfvislgggsphdcakaialvatnggevkdye gidkskkpalplmsinttagtasemtrfciitdevrhvkmaivdrhvtpmvsvndpllmv gmpkgltaatgmdalthafeaysstaatpitdacalkaasmiaknlktacdngkdmpare amayaqflagmafnnaslgyvhamahqlggyynlphgvcnavllphvlaynasvvagrlk dvgvamgldianlgdkegaeatiqavrdlaasigipanltelgakkedvplladhalkda caltnprqgdqkeveelflsaf
Timeline for d3ox4b_: