Lineage for d1mrel1 (1mre L:1-108)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 450779Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 450780Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (27 proteins)
  6. 451612Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 451743Species Mouse (Mus musculus), cluster 1.1 [TaxId:10090] [88524] (126 PDB entries)
  8. 451808Domain d1mrel1: 1mre L:1-108 [20018]
    Other proteins in same PDB: d1mreh1, d1mreh2, d1mrel2
    part of Fab Jel 103

Details for d1mrel1

PDB Entry: 1mre (more details), 2.3 Å

PDB Description: preparation, characterization and crystallization of an antibody fab fragment that recognizes rna. crystal structures of native fab and three fab-mononucleotide complexes

SCOP Domain Sequences for d1mrel1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mrel1 b.1.1.1 (L:1-108) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1}
dvvmtqtplslpvslgdqasiscrssqslvhsngntylhwylqkpgqspklliykvsnrf
sgvpdrfsgsgsgtdftlkisrveaedlgvyfcsqsthvprtfgggtkleikr

SCOP Domain Coordinates for d1mrel1:

Click to download the PDB-style file with coordinates for d1mrel1.
(The format of our PDB-style files is described here.)

Timeline for d1mrel1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mrel2