SCOP 1.57: Domain d1mrel1: 1mre L:1-108

Lineage for d1mrel1 (1mre L:1-108)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species)

7. Species Fab Jel 103 (mouse), kappa L chain [48794] (4 PDB entries)

8. Domain d1mrel1: 1mre L:1-108 [20018]
   Other proteins in same PDB: d1mreh2, d1mrel2

Details for d1mrel1

PDB Entry: 1mre, 2.3 Å

PDB Description: preparation, characterization and crystallization of an antibody fab fragment that recognizes rna. crystal structures of native fab and three fab-mononucleotide complexes

SCOP Domain Sequences for d1mrel1:

Sequence; same for both SEQRES and ATOM records:

>d1mrel1 b.1.1.1 (L:1-108) Immunoglobulin (variable domains of L and H chains) {Fab Jel 103 (mouse), kappa L chain}
dvvmtqtplslpvslgdqasiscrssqslvhsngntylhwylqkpgqspklliykvsnrf
sgvpdrfsgsgsgtdftlkisrveaedlgvyfcsqsthvprtfgggtkleikr

Timeline for d1mrel1:

• d1mrel1 first appeared (with stable ids) in SCOP 1.55
  
• d1mrel1 appears in SCOP 1.59
  
• d1mrel1 appears in the current release, SCOPe 2.08