Lineage for d3owen1 (3owe N:1-115)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1787538Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1787828Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 1788594Family b.40.2.0: automated matches [227133] (1 protein)
    not a true family
  6. 1788595Protein automated matches [226834] (5 species)
    not a true protein
  7. 1788596Species Staphylococcus aureus [TaxId:1280] [225054] (7 PDB entries)
  8. 1788609Domain d3owen1: 3owe N:1-115 [200177]
    Other proteins in same PDB: d3owea_, d3oweb2, d3owec_, d3owed2, d3owee_, d3owef2, d3oweg_, d3oweh2, d3owei_, d3owej2, d3owek_, d3owel2, d3owem_, d3owen2, d3oweo_, d3owep2
    automated match to d1d5zc1
    mutant

Details for d3owen1

PDB Entry: 3owe (more details), 2.6 Å

PDB Description: Crystal Structure of Staphylococcal Enterotoxin G (SEG) in Complex with a High Affinity Mutant Mouse T-cell Receptor Chain
PDB Compounds: (N:) Enterotoxin SEG

SCOPe Domain Sequences for d3owen1:

Sequence, based on SEQRES records: (download)

>d3owen1 b.40.2.0 (N:1-115) automated matches {Staphylococcus aureus [TaxId: 1280]}
aqpdpkldelnkvsdyksnkgtmgnvmnlymsppvegrgvinsrqflshdlifpieyksy
nevktelentelannykgkkvdifgvpyfytciipksepdinqnfggccmyggltf

Sequence, based on observed residues (ATOM records): (download)

>d3owen1 b.40.2.0 (N:1-115) automated matches {Staphylococcus aureus [TaxId: 1280]}
aqpdpkldelnkvsdyksnkgtmgnvmnlymsppvegrgvinsrqflshdlifpieyksy
nevktelentelannykgkkvdifgvpyfytciipksefggccmyggltf

SCOPe Domain Coordinates for d3owen1:

Click to download the PDB-style file with coordinates for d3owen1.
(The format of our PDB-style files is described here.)

Timeline for d3owen1: