Lineage for d3owel1 (3owe L:1-115)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1313473Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1313712Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 1314466Family b.40.2.0: automated matches [227133] (1 protein)
    not a true family
  6. 1314467Protein automated matches [226834] (4 species)
    not a true protein
  7. 1314468Species Staphylococcus aureus [TaxId:1280] [225054] (6 PDB entries)
  8. 1314480Domain d3owel1: 3owe L:1-115 [200175]
    Other proteins in same PDB: d3owea_, d3oweb2, d3owec_, d3owed2, d3owee_, d3owef2, d3oweg_, d3oweh2, d3owei_, d3owej2, d3owek_, d3owel2, d3owem_, d3owen2, d3oweo_, d3owep2
    automated match to d1d5zc1
    mutant

Details for d3owel1

PDB Entry: 3owe (more details), 2.6 Å

PDB Description: Crystal Structure of Staphylococcal Enterotoxin G (SEG) in Complex with a High Affinity Mutant Mouse T-cell Receptor Chain
PDB Compounds: (L:) Enterotoxin SEG

SCOPe Domain Sequences for d3owel1:

Sequence, based on SEQRES records: (download)

>d3owel1 b.40.2.0 (L:1-115) automated matches {Staphylococcus aureus [TaxId: 1280]}
aqpdpkldelnkvsdyksnkgtmgnvmnlymsppvegrgvinsrqflshdlifpieyksy
nevktelentelannykgkkvdifgvpyfytciipksepdinqnfggccmyggltf

Sequence, based on observed residues (ATOM records): (download)

>d3owel1 b.40.2.0 (L:1-115) automated matches {Staphylococcus aureus [TaxId: 1280]}
aqpdpkldelnkvsdyksnkgtmgnvmnlymsppvegrgvinsrqflshdlifpieyksy
nevktelentelannykgkkvdifgvpyfytciipksefggccmyggltf

SCOPe Domain Coordinates for d3owel1:

Click to download the PDB-style file with coordinates for d3owel1.
(The format of our PDB-style files is described here.)

Timeline for d3owel1: