SCOPe 2.06: Domain d3owej2: 3owe J:116-233

Lineage for d3owej2 (3owe J:116-233)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families)

5. Family d.15.6.0: automated matches [227139] (1 protein)
   not a true family

6. Protein automated matches [226841] (5 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:1280] [225055] (8 PDB entries)

8. Domain d3owej2: 3owe J:116-233 [200174]
   Other proteins in same PDB: d3owea_, d3oweb1, d3oweb3, d3owec_, d3owed1, d3owed3, d3owee_, d3owef1, d3owef3, d3oweg_, d3oweh1, d3oweh3, d3owei_, d3owej1, d3owej3, d3owek_, d3owel1, d3owel3, d3owem_, d3owen1, d3owen3, d3oweo_, d3owep1, d3owep3
   automated match to d1d5zc2
   mutant

Details for d3owej2

PDB Entry: 3owe, 2.6 Å

PDB Description: Crystal Structure of Staphylococcal Enterotoxin G (SEG) in Complex with a High Affinity Mutant Mouse T-cell Receptor Chain

PDB Compounds: (J:) Enterotoxin SEG

SCOPe Domain Sequences for d3owej2:

Sequence, based on SEQRES records:

>d3owej2 d.15.6.0 (J:116-233) automated matches {Staphylococcus aureus [TaxId: 1280]}
nssenerdklitvqvtidnrqslgftittnknmvtiqeldykarhwltkekklyefdgsa
fesgyikfteknntsfwfdlfpkkelvpfvpykflniygdnkvvdsksikmevflnth

Sequence, based on observed residues (ATOM records):

>d3owej2 d.15.6.0 (J:116-233) automated matches {Staphylococcus aureus [TaxId: 1280]}
nssenrdklitvqvtidnrqslgftittnknmvtiqeldykarhwltkekklyefdgsaf
esgyikfteknntsfwfdlfpkkelvpfvpykflniygdnkvvdsksikmevflnth

Timeline for d3owej2:

• d3owej2 first appeared in SCOPe 2.03
  
• d3owej2 appears in SCOPe 2.05
  
• d3owej2 appears in SCOPe 2.07
  
• d3owej2 appears in the current release, SCOPe 2.08