![]() | Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families) ![]() |
![]() | Family d.15.6.0: automated matches [227139] (1 protein) not a true family |
![]() | Protein automated matches [226841] (5 species) not a true protein |
![]() | Species Staphylococcus aureus [TaxId:1280] [225055] (6 PDB entries) |
![]() | Domain d3owed2: 3owe D:116-233 [200168] Other proteins in same PDB: d3owea_, d3oweb1, d3owec_, d3owed1, d3owee_, d3owef1, d3oweg_, d3oweh1, d3owei_, d3owej1, d3owek_, d3owel1, d3owem_, d3owen1, d3oweo_, d3owep1 automated match to d1d5zc2 mutant |
PDB Entry: 3owe (more details), 2.6 Å
SCOPe Domain Sequences for d3owed2:
Sequence, based on SEQRES records: (download)
>d3owed2 d.15.6.0 (D:116-233) automated matches {Staphylococcus aureus [TaxId: 1280]} nssenerdklitvqvtidnrqslgftittnknmvtiqeldykarhwltkekklyefdgsa fesgyikfteknntsfwfdlfpkkelvpfvpykflniygdnkvvdsksikmevflnth
>d3owed2 d.15.6.0 (D:116-233) automated matches {Staphylococcus aureus [TaxId: 1280]} nssenrdklitvqvtidnrqslgftittnknmvtiqeldykarhwltkekklyefdgsaf esgyikfteknntsfwfdlfpkkelvpfvpykflniygdnkvvdsksikmevflnth
Timeline for d3owed2: