SCOPe 2.07: Domain d3otwe_: 3otw E:

Lineage for d3otwe_ (3otw E:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families)

5. Family c.26.1.0: automated matches [191377] (1 protein)
   not a true family

6. Protein automated matches [190459] (59 species)
   not a true protein

7. Species Helicobacter pylori [TaxId:85962] [193641] (2 PDB entries)

8. Domain d3otwe_: 3otw E: [200162]
   automated match to d3otwf_
   complexed with coa, so4

Details for d3otwe_

PDB Entry: 3otw, 1.8 Å

PDB Description: Structural and Functional Studies of Helicobacter pylori Wild-Type and Mutated Proteins Phosphopantetheine adenylyltransferase

PDB Compounds: (E:) phosphopantetheine adenylyltransferase

SCOPe Domain Sequences for d3otwe_:

Sequence; same for both SEQRES and ATOM records:

>d3otwe_ c.26.1.0 (E:) automated matches {Helicobacter pylori [TaxId: 85962]}
mqkigiypgtfdpvtnghidiihrsselfeklivavahssaknpmfslderlkmiqlatk
sfknvecvafegllanlakeyhckvlvrglrvvsdfeyelqmgyankslnheletlyfmp
tlqnafisssivrsiiahkgdashlvpkeiyplisk

Timeline for d3otwe_:

• d3otwe_ first appeared in SCOPe 2.03
  
• d3otwe_ appears in SCOPe 2.06
  
• d3otwe_ appears in the current release, SCOPe 2.08