SCOPe 2.06: Domain d3orwa_: 3orw A:

Lineage for d3orwa_ (3orw A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families)
   the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
   has transition metal ions bound inside the barrel

5. Family c.1.9.0: automated matches [191327] (1 protein)
   not a true family

6. Protein automated matches [190150] (26 species)
   not a true protein

7. Species Geobacillus kaustophilus [TaxId:1462] [189526] (16 PDB entries)

8. Domain d3orwa_: 3orw A: [200157]
   automated match to d3orwb_
   complexed with co

Details for d3orwa_

PDB Entry: 3orw, 2.4 Å

PDB Description: crystal structure of thermophilic phosphotriesterase from geobacillus kaustophilus hta426

PDB Compounds: (A:) phosphotriesterase

SCOPe Domain Sequences for d3orwa_:

Sequence; same for both SEQRES and ATOM records:

>d3orwa_ c.1.9.0 (A:) automated matches {Geobacillus kaustophilus [TaxId: 1462]}
emvetvcgpvpveqlgktlihehflfgypgfqgdvtrgtfredeslrvaveaaekmkrhg
iqtvvdptpndcgrnpaflrrvaeetglniicatgyyyegegappyfqfrrllgtaeddi
ydmfmaeltegiadtgikagviklasskgriteyekmffraaaraqketgaviithtqeg
tmgpeqaayllehgadpkkivighmcgntdpdyhrktlaygvyiafdrfgiqgmvgaptd
eervrtllallrdgyekqimlshdtvnvwlgrpftlpepfaemmknwhvehlfvniipal
knegirdevleqmfignpaalfsa

Timeline for d3orwa_:

• d3orwa_ first appeared in SCOPe 2.03
  
• d3orwa_ appears in SCOPe 2.05
  
• d3orwa_ appears in SCOPe 2.07
  
• d3orwa_ appears in the current release, SCOPe 2.08