SCOP 1.61: Domain d1eapb1: 1eap B:1-124

Lineage for d1eapb1 (1eap B:1-124)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species)

7. Species Fab 17E8 (mouse), kappa L chain [48793] (1 PDB entry)

8. Domain d1eapb1: 1eap B:1-124 [20015]
   Other proteins in same PDB: d1eapa2, d1eapb2

Details for d1eapb1

PDB Entry: 1eap, 2.5 Å

PDB Description: crystal structure of a catalytic antibody with a serine protease active site

SCOP Domain Sequences for d1eapb1:

Sequence; same for both SEQRES and ATOM records:

>d1eapb1 b.1.1.1 (B:1-124) Immunoglobulin (variable domains of L and H chains) {Fab 17E8 (mouse), kappa L chain}
evqlqesgtelvkpgasvkisckasgyistdhaihwvkqrpeqglewigyispgngdiky
nekfkvkatltadqssstaymqlnsltsedsavyfckrsyygssyvdywgqgttltvss

Timeline for d1eapb1:

• d1eapb1 first appeared (with stable ids) in SCOP 1.55
  
• d1eapb1 appears in SCOP 1.59
  
• d1eapb1 appears in SCOP 1.63
  
• d1eapb1 appears in the current release, SCOPe 2.08