Lineage for d3oqtd_ (3oqt D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3007999Fold d.230: Dodecin subunit-like [88797] (9 superfamilies)
    beta-alpha-beta(2); 2 layers: alpha/beta; antiparallel beta-sheet: order 132
  4. 3008035Superfamily d.230.2: Dodecin-like [89807] (2 families) (S)
  5. 3008137Family d.230.2.0: automated matches [191578] (1 protein)
    not a true family
  6. 3008138Protein automated matches [191015] (5 species)
    not a true protein
  7. 3008152Species Mycobacterium tuberculosis [TaxId:1773] [196318] (1 PDB entry)
  8. 3008156Domain d3oqtd_: 3oqt D: [200136]
    automated match to d3oqtp_
    complexed with cl, na

Details for d3oqtd_

PDB Entry: 3oqt (more details), 2.88 Å

PDB Description: Crystal structure of Rv1498A protein from mycobacterium tuberculosis
PDB Compounds: (D:) Rv1498A PROTEIN

SCOPe Domain Sequences for d3oqtd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3oqtd_ d.230.2.0 (D:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
msnhtyrvieivgtspdgvdaaiqgglaraaqtmraldwfevqsirghlvdgavahfqvt
mkvgfrleds

SCOPe Domain Coordinates for d3oqtd_:

Click to download the PDB-style file with coordinates for d3oqtd_.
(The format of our PDB-style files is described here.)

Timeline for d3oqtd_: