Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.230: Dodecin subunit-like [88797] (9 superfamilies) beta-alpha-beta(2); 2 layers: alpha/beta; antiparallel beta-sheet: order 132 |
Superfamily d.230.2: Dodecin-like [89807] (2 families) |
Family d.230.2.0: automated matches [191578] (1 protein) not a true family |
Protein automated matches [191015] (5 species) not a true protein |
Species Mycobacterium tuberculosis [TaxId:1773] [196318] (1 PDB entry) |
Domain d3oqtd_: 3oqt D: [200136] automated match to d3oqtp_ complexed with cl, na |
PDB Entry: 3oqt (more details), 2.88 Å
SCOPe Domain Sequences for d3oqtd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3oqtd_ d.230.2.0 (D:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]} msnhtyrvieivgtspdgvdaaiqgglaraaqtmraldwfevqsirghlvdgavahfqvt mkvgfrleds
Timeline for d3oqtd_: