SCOP 1.71: Domain d1knof1: 1kno F:1-119

Lineage for d1knof1 (1kno F:1-119)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (28 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 2.2 [TaxId:10090] [88550] (49 PDB entries)

8. Domain d1knof1: 1kno F:1-119 [20013]
   Other proteins in same PDB: d1knoa1, d1knoa2, d1knob2, d1knoc1, d1knoc2, d1knod2, d1knoe1, d1knoe2, d1knof2
   part of Fab CNJ206
   complexed with pnp, zn

Details for d1knof1

PDB Entry: 1kno, 3.2 Å

PDB Description: crystal structure of the complex of a catalytic antibody fab with a transition state analog: structural similarities in esterase-like abzymes

SCOP Domain Sequences for d1knof1:

Sequence; same for both SEQRES and ATOM records:

>d1knof1 b.1.1.1 (F:1-119) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2}
dvklvesggglvqpggsrklscaasgftfssfgmhwvrqapekglewvayissgsstiyy
adtvkgrftisrdnpkntlflqmtslrsedtamyycargdyygsrgaywgqgtlvtvsa

Timeline for d1knof1:

• d1knof1 first appeared (with stable ids) in SCOP 1.55
  
• d1knof1 appears in SCOP 1.69
  
• d1knof1 appears in SCOP 1.73
  
• d1knof1 appears in the current release, SCOPe 2.08