Lineage for d1knof1 (1kno F:1-119)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 218899Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)
  6. 218958Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)
  7. 219615Species Fab CNJ206 (mouse), kappa L chain [48792] (2 PDB entries)
  8. 219621Domain d1knof1: 1kno F:1-119 [20013]
    Other proteins in same PDB: d1knoa2, d1knob2, d1knoc2, d1knod2, d1knoe2, d1knof2
    complexed with pnp, zn

Details for d1knof1

PDB Entry: 1kno (more details), 3.2 Å

PDB Description: crystal structure of the complex of a catalytic antibody fab with a transition state analog: structural similarities in esterase-like abzymes

SCOP Domain Sequences for d1knof1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1knof1 b.1.1.1 (F:1-119) Immunoglobulin (variable domains of L and H chains) {Fab CNJ206 (mouse), kappa L chain}
dvklvesggglvqpggsrklscaasgftfssfgmhwvrqapekglewvayissgsstiyy
adtvkgrftisrdnpkntlflqmtslrsedtamyycargdyygsrgaywgqgtlvtvsa

SCOP Domain Coordinates for d1knof1:

Click to download the PDB-style file with coordinates for d1knof1.
(The format of our PDB-style files is described here.)

Timeline for d1knof1: