![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily) 8-stranded mixed beta-sheet; 2 layers: alpha/beta |
![]() | Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) ![]() |
![]() | Family d.122.1.1: Heat shock protein 90, HSP90, N-terminal domain [55875] (2 proteins) |
![]() | Protein automated matches [190229] (13 species) not a true protein |
![]() | Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [189431] (2 PDB entries) |
![]() | Domain d3omua1: 3omu A:2-208 [200102] Other proteins in same PDB: d3omua2 automated match to d3omub_ complexed with ibd |
PDB Entry: 3omu (more details), 2.15 Å
SCOPe Domain Sequences for d3omua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3omua1 d.122.1.1 (A:2-208) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]} mtetfafqaeinqlmsliintfysnkeiflrelisnssdacdkiryqsltnqsvlgdeph lrirvipdrvnktltvedsgigmtkadlvnnlgtiarsgtksfmealeaggdmsmigqfg vgfysaylvadrvtvvsknneddaytwessaggtftvtstpdcdlkrgtrivlhlkedqq eyleerrlkdlikkhsefigydielmv
Timeline for d3omua1: