SCOPe 2.03: Domain d3omua_: 3omu A:

Lineage for d3omua_ (3omu A:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
   8-stranded mixed beta-sheet; 2 layers: alpha/beta

4. Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families)

5. Family d.122.1.1: Heat shock protein 90, HSP90, N-terminal domain [55875] (2 proteins)

6. Protein automated matches [190229] (8 species)
   not a true protein

7. Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [189431] (2 PDB entries)

8. Domain d3omua_: 3omu A: [200102]
   automated match to d3omub_
   complexed with ibd

Details for d3omua_

PDB Entry: 3omu, 2.15 Å

PDB Description: crystal structure of the n-terminal domain of an hsp90 from trypanosoma brucei, tb10.26.1080 in the presence of a thienopyrimidine derivative

PDB Compounds: (A:) Heat shock protein 83

SCOPe Domain Sequences for d3omua_:

Sequence; same for both SEQRES and ATOM records:

>d3omua_ d.122.1.1 (A:) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
gmtetfafqaeinqlmsliintfysnkeiflrelisnssdacdkiryqsltnqsvlgdep
hlrirvipdrvnktltvedsgigmtkadlvnnlgtiarsgtksfmealeaggdmsmigqf
gvgfysaylvadrvtvvsknneddaytwessaggtftvtstpdcdlkrgtrivlhlkedq
qeyleerrlkdlikkhsefigydielmv

Timeline for d3omua_:

• d3omua_ is new in SCOPe 2.03-stable
  
• d3omua_ appears in SCOPe 2.04
  
• d3omua_ appears in the current release, SCOPe 2.08, called d3omua1