Lineage for d3olya_ (3oly A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1356042Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1356043Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 1356044Family c.23.1.1: CheY-related [52173] (26 proteins)
  6. 1356055Protein CheY protein [52174] (5 species)
  7. 1356056Species Escherichia coli [TaxId:562] [52175] (42 PDB entries)
    Uniprot P06143
  8. 1356083Domain d3olya_: 3oly A: [200101]
    automated match to d3olyb_
    complexed with bef, gol, mn, so4

Details for d3olya_

PDB Entry: 3oly (more details), 2.05 Å

PDB Description: structural and functional effects of substitution at position t+1 in chey: cheya88m-bef3-mn complex
PDB Compounds: (A:) Chemotaxis protein cheY

SCOPe Domain Sequences for d3olya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3olya_ c.23.1.1 (A:) CheY protein {Escherichia coli [TaxId: 562]}
adkelkflvvddfstmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwnmp
nmdglellktiradgamsalpvlmvtmeakkeniiaaaqagasgyvvkpftaatleekln
kifeklgm

SCOPe Domain Coordinates for d3olya_:

Click to download the PDB-style file with coordinates for d3olya_.
(The format of our PDB-style files is described here.)

Timeline for d3olya_: