SCOPe 2.08: Domain d3olwa_: 3olw A:

Lineage for d3olwa_ (3olw A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.1: CheY-related [52173] (26 proteins)

6. Protein CheY protein [52174] (6 species)

7. Species Escherichia coli [TaxId:562] [52175] (42 PDB entries)
   Uniprot P06143

8. Domain d3olwa_: 3olw A: [200099]
   automated match to d3olwb_
   complexed with bef, cl, gol, mn, so4

Details for d3olwa_

PDB Entry: 3olw, 2.3 Å

PDB Description: structural and functional effects of substitution at position t+1 in chey: cheya88t-bef3-mn complex

PDB Compounds: (A:) Chemotaxis protein cheY

SCOPe Domain Sequences for d3olwa_:

Sequence; same for both SEQRES and ATOM records:

>d3olwa_ c.23.1.1 (A:) CheY protein {Escherichia coli [TaxId: 562]}
adkelkflvvddfstmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwnmp
nmdglellktiradgamsalpvlmvtteakkeniiaaaqagasgyvvkpftaatleekln
kifeklgm

Timeline for d3olwa_:

• d3olwa_ first appeared in SCOPe 2.03
  
• d3olwa_ appears in SCOPe 2.07