![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
![]() | Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
![]() | Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins) |
![]() | Protein automated matches [190435] (12 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [193902] (7 PDB entries) |
![]() | Domain d3oljc1: 3olj C:66-350 [200097] Other proteins in same PDB: d3olja2, d3oljb2, d3oljc2, d3oljd2 automated match to d3oljd_ complexed with na |
PDB Entry: 3olj (more details), 2.1 Å
SCOPe Domain Sequences for d3oljc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3oljc1 a.25.1.2 (C:66-350) automated matches {Human (Homo sapiens) [TaxId: 9606]} gvedepllrenprrfvifpieyhdiwqmykkaeasfwtaeevdlskdiqhweslkpeery fishvlaffaasdgivnenlverfsqevqitearcfygfqiamenihsemysllidtyik dpkereflfnaietmpcvkkkadwalrwigdkeatygervvafaavegiffsgsfasifw lkkrglmpgltfsnelisrdeglhcdfaclmfkhlvhkpseervreiiinavrieqeflt ealpvkligmnctlmkqyiefvadrlmlelgfskvfrvenpfdfm
Timeline for d3oljc1: