SCOPe 2.07: Domain d3oj2a_: 3oj2 A:

Lineage for d3oj2a_ (3oj2 A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.1: Cytokine [50353] (3 families)

5. Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (10 proteins)

6. Protein Acidic FGF (FGF1) [50357] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50359] (94 PDB entries)
   Uniprot P05230 16-152 ! Uniprot P05230

8. Domain d3oj2a_: 3oj2 A: [200090]
   Other proteins in same PDB: d3oj2c1, d3oj2c2, d3oj2d1, d3oj2d2
   automated match to d1ry7a_
   complexed with so4; mutant

Details for d3oj2a_

PDB Entry: 3oj2, 2.2 Å

PDB Description: Crystal structure of FGF1 complexed with the ectodomain of FGFR2b harboring the A172F Pfeiffer syndrome mutation

PDB Compounds: (A:) heparin-binding growth factor 1

SCOPe Domain Sequences for d3oj2a_:

Sequence; same for both SEQRES and ATOM records:

>d3oj2a_ b.42.1.1 (A:) Acidic FGF (FGF1) {Human (Homo sapiens) [TaxId: 9606]}
ppgnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikstetgq
ylamdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsckrgprt
hygqkailflplpvs

Timeline for d3oj2a_:

• d3oj2a_ first appeared in SCOPe 2.03
  
• d3oj2a_ appears in SCOPe 2.06
  
• d3oj2a_ appears in the current release, SCOPe 2.08