Lineage for d3oj1a_ (3oj1 A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2299347Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2299348Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2299432Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2299472Protein Dehaloperoxidase [46530] (1 species)
  7. 2299473Species Amphitrite ornata [TaxId:129555] [46531] (32 PDB entries)
  8. 2299496Domain d3oj1a_: 3oj1 A: [200089]
    automated match to d3ok5a_
    complexed with hem, so4; mutant

Details for d3oj1a_

PDB Entry: 3oj1 (more details), 1.52 Å

PDB Description: Structure of the H55D mutant of dehaloperoxidase-hemoglobin A from Amphitrite ornata
PDB Compounds: (A:) Dehaloperoxidase A

SCOPe Domain Sequences for d3oj1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3oj1a_ a.1.1.2 (A:) Dehaloperoxidase {Amphitrite ornata [TaxId: 129555]}
gfkqdiatirgdlrtyaqdiflaflnkypderryfknyvgksdqelksmakfgddtekvf
nlmmevadratdcvplasdantlvqmkqhsslttgnfeklfvalveymrasgqsfdsqsw
drfgknlvsalssagmk

SCOPe Domain Coordinates for d3oj1a_:

Click to download the PDB-style file with coordinates for d3oj1a_.
(The format of our PDB-style files is described here.)

Timeline for d3oj1a_: