SCOPe 2.08: Domain d3oj1a_: 3oj1 A:

Lineage for d3oj1a_ (3oj1 A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Dehaloperoxidase [46530] (1 species)

7. Species Amphitrite ornata [TaxId:129555] [46531] (32 PDB entries)

8. Domain d3oj1a_: 3oj1 A: [200089]
   automated match to d3ok5a_
   complexed with hem, so4; mutant

Details for d3oj1a_

PDB Entry: 3oj1, 1.52 Å

PDB Description: Structure of the H55D mutant of dehaloperoxidase-hemoglobin A from Amphitrite ornata

PDB Compounds: (A:) Dehaloperoxidase A

SCOPe Domain Sequences for d3oj1a_:

Sequence; same for both SEQRES and ATOM records:

>d3oj1a_ a.1.1.2 (A:) Dehaloperoxidase {Amphitrite ornata [TaxId: 129555]}
gfkqdiatirgdlrtyaqdiflaflnkypderryfknyvgksdqelksmakfgddtekvf
nlmmevadratdcvplasdantlvqmkqhsslttgnfeklfvalveymrasgqsfdsqsw
drfgknlvsalssagmk

Timeline for d3oj1a_:

• d3oj1a_ first appeared in SCOPe 2.03
  
• d3oj1a_ appears in SCOPe 2.07