SCOPe 2.03: Domain d3ogna_: 3ogn A:

Lineage for d3ogna_ (3ogn A:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.2: Insect pheromone/odorant-binding proteins [47565] (2 families)
   the N-terminal extension, containing a few short helices, forms a flexible lid for the binding cavity

5. Family a.39.2.0: automated matches [191595] (1 protein)
   not a true family

6. Protein automated matches [191085] (6 species)
   not a true protein

7. Species Culex quinquefasciatus [TaxId:7176] [193717] (1 PDB entry)

8. Domain d3ogna_: 3ogn A: [200087]
   automated match to d3ognb_
   complexed with 3og, mg

Details for d3ogna_

PDB Entry: 3ogn, 1.3 Å

PDB Description: Crystal Structure of an Odorant-binding Protein from the Southern House Mosquito Complexed with an Oviposition Pheromone

PDB Compounds: (A:) odorant-binding protein

SCOPe Domain Sequences for d3ogna_:

Sequence; same for both SEQRES and ATOM records:

>d3ogna_ a.39.2.0 (A:) automated matches {Culex quinquefasciatus [TaxId: 7176]}
vtprrdaeypppellealkplhdicakktgvtdeaiiefsdgkihedeklkcymnclfhe
akvvddngdvhleklhdslpnsmhdiamhmgkrclypegenlcekafwlhkcwkqadpkh
yflv

Timeline for d3ogna_:

• d3ogna_ is new in SCOPe 2.03-stable
  
• d3ogna_ appears in SCOPe 2.04
  
• d3ogna_ appears in the current release, SCOPe 2.08