Lineage for d3ofta_ (3oft A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2005528Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2005529Protein automated matches [190847] (63 species)
    not a true protein
  7. 2005772Species Novosphingobium aromaticivorans [TaxId:279238] [189372] (11 PDB entries)
  8. 2005773Domain d3ofta_: 3oft A: [200085]
    automated match to d3ofua_
    complexed with hem, hx2

Details for d3ofta_

PDB Entry: 3oft (more details), 1.9 Å

PDB Description: Crystal Structure of Cytochrome P450 CYP101C1
PDB Compounds: (A:) cytochrome p450

SCOPe Domain Sequences for d3ofta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ofta_ a.104.1.0 (A:) automated matches {Novosphingobium aromaticivorans [TaxId: 279238]}
mipahvpadrvvdfdifnppgveqdyfaawktlldgpglvwstangghwiaargdvvrel
wgdaerlssqclavtpglgkvmqfiplqqdgaehkafrtpvmkglasrfvvalepkvqav
arklmeslrprgscdfvsdfaeilplnifltlidvpledrprlrqlgvqltrpdgsmtve
qlkqaaddylwpfiekrmaqpgddlfsrilsepvggrpwtvdearrmcrnllfggldtva
amigmvalhlarhpedqrllrerpdlipaaadelmrryptvavsrnavadvdadgvtirk
gdlvylpsvlhnldpasfeapeevrfdrglapirhttmgvgahrcvgaglarmevivflr
ewlggmpefalapdkavtmkggnvgactalplvwra

SCOPe Domain Coordinates for d3ofta_:

Click to download the PDB-style file with coordinates for d3ofta_.
(The format of our PDB-style files is described here.)

Timeline for d3ofta_: