![]() | Class b: All beta proteins [48724] (119 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins) |
![]() | Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species) |
![]() | Species Fab CNJ206 (mouse), kappa L chain [48792] (2 PDB entries) |
![]() | Domain d1knoa1: 1kno A:1-108 [20008] Other proteins in same PDB: d1knoa2, d1knob2, d1knoc2, d1knod2, d1knoe2, d1knof2 |
PDB Entry: 1kno (more details), 3.2 Å
SCOP Domain Sequences for d1knoa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1knoa1 b.1.1.1 (A:1-108) Immunoglobulin (variable domains of L and H chains) {Fab CNJ206 (mouse), kappa L chain} qiqmtqspsslsaslgervsltcrasqeisgylswlqqkpdgtikrliyaastldsgvpk rfsgsrsgsdysltisslesedfadyyclqyasspytfgggtkleilr
Timeline for d1knoa1: