Lineage for d2gfbo1 (2gfb O:1-108)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 450779Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 450780Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (27 proteins)
  6. 451612Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 452039Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88531] (162 PDB entries)
  8. 452244Domain d2gfbo1: 2gfb O:1-108 [20006]
    Other proteins in same PDB: d2gfba2, d2gfbb1, d2gfbb2, d2gfbc2, d2gfbd1, d2gfbd2, d2gfbe2, d2gfbf1, d2gfbf2, d2gfbg2, d2gfbh1, d2gfbh2, d2gfbi2, d2gfbj1, d2gfbj2, d2gfbk2, d2gfbl1, d2gfbl2, d2gfbm2, d2gfbn1, d2gfbn2, d2gfbo2, d2gfbp1, d2gfbp2
    part of Fab CNJ206; H-chains in this entry seem to be mistraced in VH region

Details for d2gfbo1

PDB Entry: 2gfb (more details), 3 Å

PDB Description: crystal structure of a catalytic fab having esterase-like activity

SCOP Domain Sequences for d2gfbo1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gfbo1 b.1.1.1 (O:1-108) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4}
qiqmtqspsslsaslgervsltcrasqeisgylswlqqkpdgtikrliyaastldsgvpk
rfsgsrsgsdysltisslesedfadyyclqyasspytfgggtkleilr

SCOP Domain Coordinates for d2gfbo1:

Click to download the PDB-style file with coordinates for d2gfbo1.
(The format of our PDB-style files is described here.)

Timeline for d2gfbo1: