![]() | Class b: All beta proteins [48724] (119 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins) |
![]() | Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species) |
![]() | Species Fab CNJ206 (mouse), kappa L chain [48792] (2 PDB entries) |
![]() | Domain d2gfbo1: 2gfb O:1-108 [20006] Other proteins in same PDB: d2gfba2, d2gfbb2, d2gfbc2, d2gfbd2, d2gfbe2, d2gfbf2, d2gfbg2, d2gfbh2, d2gfbi2, d2gfbj2, d2gfbk2, d2gfbl2, d2gfbm2, d2gfbn2, d2gfbo2, d2gfbp2 |
PDB Entry: 2gfb (more details), 3 Å
SCOP Domain Sequences for d2gfbo1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gfbo1 b.1.1.1 (O:1-108) Immunoglobulin (variable domains of L and H chains) {Fab CNJ206 (mouse), kappa L chain} qiqmtqspsslsaslgervsltcrasqeisgylswlqqkpdgtikrliyaastldsgvpk rfsgsrsgsdysltisslesedfadyyclqyasspytfgggtkleilr
Timeline for d2gfbo1:
![]() Domains from other chains: (mouse over for more information) d2gfba1, d2gfba2, d2gfbb1, d2gfbb2, d2gfbc1, d2gfbc2, d2gfbd1, d2gfbd2, d2gfbe1, d2gfbe2, d2gfbf1, d2gfbf2, d2gfbg1, d2gfbg2, d2gfbh1, d2gfbh2, d2gfbi1, d2gfbi2, d2gfbj1, d2gfbj2, d2gfbk1, d2gfbk2, d2gfbl1, d2gfbl2, d2gfbm1, d2gfbm2, d2gfbn1, d2gfbn2, d2gfbp1, d2gfbp2 |