Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (14 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [224855] (368 PDB entries) |
Domain d3o9wd2: 3o9w D:113-240 [200030] Other proteins in same PDB: d3o9wa1, d3o9wb_, d3o9wc1, d3o9wd1 automated match to d1lp9f2 complexed with 1o2, nag |
PDB Entry: 3o9w (more details), 2.8 Å
SCOPe Domain Sequences for d3o9wd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3o9wd2 b.1.1.2 (D:113-240) automated matches {Mouse (Mus musculus) [TaxId: 10090]} dlrnvtppkvslfepskaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq plkeqpalndsryslssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv saeawgra
Timeline for d3o9wd2: