Lineage for d2gfbl1 (2gfb L:1-119)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 218899Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)
  6. 218958Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)
  7. 219615Species Fab CNJ206 (mouse), kappa L chain [48792] (2 PDB entries)
  8. 219633Domain d2gfbl1: 2gfb L:1-119 [20003]
    Other proteins in same PDB: d2gfba2, d2gfbb2, d2gfbc2, d2gfbd2, d2gfbe2, d2gfbf2, d2gfbg2, d2gfbh2, d2gfbi2, d2gfbj2, d2gfbk2, d2gfbl2, d2gfbm2, d2gfbn2, d2gfbo2, d2gfbp2

Details for d2gfbl1

PDB Entry: 2gfb (more details), 3 Å

PDB Description: crystal structure of a catalytic fab having esterase-like activity

SCOP Domain Sequences for d2gfbl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gfbl1 b.1.1.1 (L:1-119) Immunoglobulin (variable domains of L and H chains) {Fab CNJ206 (mouse), kappa L chain}
dvklvesggglvqpggsrklscaasgftfssfgmhwvrqapekglewvayissgsstiyy
adtvkgrftisrdnpkntlflqmtslrsedtamyycargdyygsrgaywgqgtlvtvsak
ttap

SCOP Domain Coordinates for d2gfbl1:

Click to download the PDB-style file with coordinates for d2gfbl1.
(The format of our PDB-style files is described here.)

Timeline for d2gfbl1: