Lineage for d3o9wc2 (3o9w C:118-206)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2025133Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2029182Protein automated matches [190374] (16 species)
    not a true protein
  7. 2030580Species Mouse (Mus musculus) [TaxId:10090] [224855] (498 PDB entries)
  8. 2030962Domain d3o9wc2: 3o9w C:118-206 [200028]
    Other proteins in same PDB: d3o9wa1, d3o9wb_, d3o9wc1, d3o9wd1
    automated match to d1qrnd2
    complexed with 1o2, nag

Details for d3o9wc2

PDB Entry: 3o9w (more details), 2.8 Å

PDB Description: recognition of a glycolipid antigen by the inkt cell tcr
PDB Compounds: (C:) Valpha14 chimera (Mouse variable domain, Human T-cell receptor alpha chain C region constant domain)

SCOPe Domain Sequences for d3o9wc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3o9wc2 b.1.1.2 (C:118-206) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffps

SCOPe Domain Coordinates for d3o9wc2:

Click to download the PDB-style file with coordinates for d3o9wc2.
(The format of our PDB-style files is described here.)

Timeline for d3o9wc2: