Lineage for d3o9wc1 (3o9w C:1-117)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1764871Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1764872Protein automated matches [190740] (26 species)
    not a true protein
  7. 1766572Species Mouse (Mus musculus) [TaxId:10090] [188198] (413 PDB entries)
  8. 1766984Domain d3o9wc1: 3o9w C:1-117 [200027]
    Other proteins in same PDB: d3o9wa1, d3o9wa2, d3o9wb_, d3o9wc2, d3o9wd1, d3o9wd2
    automated match to d1qrnd1
    complexed with 1o2, nag

Details for d3o9wc1

PDB Entry: 3o9w (more details), 2.8 Å

PDB Description: recognition of a glycolipid antigen by the inkt cell tcr
PDB Compounds: (C:) Valpha14 chimera (Mouse variable domain, Human T-cell receptor alpha chain C region constant domain)

SCOPe Domain Sequences for d3o9wc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3o9wc1 b.1.1.0 (C:1-117) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
tqveqspqslvvrqgencvlqcnysvtpdnhlrwfkqdtgkglvsltvlvdqkdktsngr
ysatldkdakhstlhitatllddtatyicvvgdrgsalgrlhfgagtqlivipd

SCOPe Domain Coordinates for d3o9wc1:

Click to download the PDB-style file with coordinates for d3o9wc1.
(The format of our PDB-style files is described here.)

Timeline for d3o9wc1: