SCOPe 2.08: Domain d3o9wc1: 3o9w C:1-117

Lineage for d3o9wc1 (3o9w C:1-117)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d3o9wc1: 3o9w C:1-117 [200027]
   Other proteins in same PDB: d3o9wa1, d3o9wa2, d3o9wb_, d3o9wc2, d3o9wd1, d3o9wd2
   automated match to d1qrnd1
   complexed with 1o2, nag

Details for d3o9wc1

PDB Entry: 3o9w, 2.8 Å

PDB Description: recognition of a glycolipid antigen by the inkt cell tcr

PDB Compounds: (C:) Valpha14 chimera (Mouse variable domain, Human T-cell receptor alpha chain C region constant domain)

SCOPe Domain Sequences for d3o9wc1:

Sequence; same for both SEQRES and ATOM records:

>d3o9wc1 b.1.1.0 (C:1-117) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tqveqspqslvvrqgencvlqcnysvtpdnhlrwfkqdtgkglvsltvlvdqkdktsngr
ysatldkdakhstlhitatllddtatyicvvgdrgsalgrlhfgagtqlivipd

Timeline for d3o9wc1:

• d3o9wc1 first appeared in SCOPe 2.03
  
• d3o9wc1 appears in SCOPe 2.07