Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.0: automated matches [227140] (1 protein) not a true family |
Protein automated matches [226842] (5 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [224924] (70 PDB entries) |
Domain d3o9wa1: 3o9w A:6-185 [200025] Other proteins in same PDB: d3o9wa2, d3o9wb_, d3o9wc1, d3o9wc2, d3o9wd1, d3o9wd2 automated match to d1onqa2 complexed with 1o2, nag |
PDB Entry: 3o9w (more details), 2.8 Å
SCOPe Domain Sequences for d3o9wa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3o9wa1 d.19.1.0 (A:6-185) automated matches {Mouse (Mus musculus) [TaxId: 10090]} knytfrclqmssfanrswsrtdsvvwlgdlqthrwsndsatisftkpwsqgklsnqqwek lqhmfqvyrvsftrdiqelvkmmspkedypieiqlsagcemypgnasesflhvafqgkyv vrfwgtswqtvpgapswldlpikvlnadqgtsatvqmllndtcplfvrglleagksdlek
Timeline for d3o9wa1: